20210801 20180803 20180425 20210801 IID00179 Cbp/p300-interacting transactivator 2 MSG-related protein 1 P35srj Homo sapiens 270 Q99967 O95426 Q5VTF4 Transcriptional coactivator of the p300/CBP-mediated transcription complex. Acts as a bridge, linking TFAP2 transcription factors and the p300/CBP transcriptional coactivator complex in order to stimulate TFAP2-mediated transcriptional activation. Positively regulates TGF-beta signaling through its association with the SMAD/p300/CBP-mediated transcriptional coactivator complex. Stimulates the peroxisome proliferator-activated receptors PPARA transcriptional activity. Enhances estrogen-dependent transactivation mediated by estrogen receptors. Acts also as a transcriptional corepressor; interferes with the binding of the transcription factors HIF1A or STAT2 and the p300/CBP transcriptional coactivator complex. Participates in sex determination and early gonad development by stimulating transcription activation of SRY. Plays a role in controlling left-right patterning during embryogenesis; potentiates transcriptional activation of NODAL-mediated gene transcription in the left lateral plate mesoderm (LPM). Plays an essential role in differentiation of the adrenal cortex from the adrenogonadal primordium (AGP); stimulates WT1-mediated transcription activation thereby up-regulating the nuclear hormone receptor NR5A1 promoter activity. Associates with chromatin to the PITX2 P1 promoter region. Nucleus. SL-0191 unkown MADHMMAMNHGRFPDGTNGLHHHPAHRMGMGQFPSPHHHQQQQPQHAFNALMGEHIHYGAGNMNATSGIRHAMGPGTVNGGHPPSALAPAARFNNSQFMGPPVASQGGSLPASMQLQKLNNQYFNHHPYPHNHYMPDLHPAAGHQMNGTNQHFRDCNPKHSGGSSTPGGSGGSSTPGGSGSSSGGGAGSSNSGGGSGSGNMPASVAHVPAAMLPPNVIDTDFIDEEVLMSLVIEMGLDRIKELPELWLGQNEFDFMTDFVCKQQPSRVSC 1 1p4qA 216 259 order 1 2 1r8uA 220 269 order 2 3 220 269 disorder 3 4 1p4qA 259 259 high_rmsd 1 5 1r8uA 259 269 high_rmsd 2 1 1p4q NMR 12778114 S.J.FREEDMAN,Z.Y.SUN,A.L.KUNG,D.S.FRANCE,G.WAGNER,M.J.ECK 2003 NAT.STRUCT.BIOL. 10 504 nmr 1p4q A 216 259 96 0 1 1p4q_1 2892 Hetero dimer 1p4qA Q99967 IID00179 1p4qB Q09472 IID00070 1p4qA-1p4qB 2 1r8u NMR 14594809 R.N.DE GUZMAN,M.A.MARTINEZ-YAMOUT,H.J.DYSON,P.E.WRIGHT 2004 J.BIOL.CHEM. 279 3042 nmr 1r8u A 220 269 100 0 1 1r8u 3871 Hetero dimer 1r8uB P45481 IID50008 1r8uA Q99967 IID00179 1r8uA-1r8uB 3 CD,NMR 14594809 R.N.DE GUZMAN,M.A.MARTINEZ-YAMOUT,H.J.DYSON,P.E.WRIGHT 2004 J.BIOL.CHEM. 279 3042 ProS 1 verified 1,2 216 269 3 220 269 216-269 1-215,270-270 524 PF04487 1->270 1.7e-128 CITED hmm pfm 5740 PF04487 1->270 2e-28 CITED rps pfm