20210801 20180803 20180425 20210801 IID00204 Serine/arginine-rich splicing factor 3 Pre-mRNA-splicing factor SRP20 Splicing factor, arginine/serine-rich 3 Homo sapiens 164 P84103 B4E241 O08831 P23152 Q5R3K0 Splicing factor that specifically promotes exon-inclusion during alternative splicing (PubMed:26876937). Interaction with YTHDC1, a RNA-binding protein that recognizes and binds N6-methyladenosine (m6A)-containing RNAs, promotes recruitment of SRSF3 to its mRNA-binding elements adjacent to m6A sites, leading to exon-inclusion during alternative splicing (PubMed:26876937). Also functions as export adapter involved in mRNA nuclear export such as of histone H2A (PubMed:11336712, PubMed:18364396). Binds mRNA which is thought to be transferred to the NXF1-NXT1 heterodimer for export (TAP/NXF1 pathway); enhances NXF1-NXT1 RNA-binding activity (PubMed:11336712, PubMed:18364396). RNA-binding is semi-sequence specific (PubMed:17036044). Cytoplasm. SL-0086 unkown Nucleus speckle. SL-0186 reported Nucleus. SL-0191 unkown N-acetylmethionine 1 1 Phosphoserine 5 5 N6-acetyllysine 23 23 MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRSRNRGPPPSWGRRPRDDYRRRSPPPRRRSPRRRSFSRSRSRSLSRDRRRERSLSRERNHKPSRSFSRSRSRSRSNERK 1 2i2yA 1 86 order 2 2 2i38A 1 86 order 1 1 2i38 NMR 17036044 Y.HARGOUS,G.M.HAUTBERGUE,A.M.TINTARU,L.SKRISOVSKA,A.P.GOLOVANOV,J.STEVENIN,L.Y.LIAN,S.A.WILSON,F.H.ALLAIN 2006 EMBO J. 25 5126 nmr 2i38 A 1 86 98 0 1 2i38_1 4748 Monomer monomer 2i38A P84103 IID00204 2i38A P19909 2i38A-2i38A 2 2i2y NMR 17036044 Y.HARGOUS,G.M.HAUTBERGUE,A.M.TINTARU,L.SKRISOVSKA,A.P.GOLOVANOV,J.STEVENIN,L.Y.LIAN,S.A.WILSON,F.H.ALLAIN 2006 EMBO J. 25 5126 nmr 2i2y A 1 86 100 0 1 2i2y 4745 Monomer monomer 2i2yA P84103 IID00204 2i2yA P19909 2i2yA-2i2yA 1-85 86-164 624 PF00076 12->77 2.4e-22 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) hmm pfm 3452 1qm9A1 9->112 1.1e-25 hmm scp 5822 PF11835 26->81 1e-05 RRM-like domain rps pfm 8371 2n3lA1 1->85 1e-24 rps scp