20210801 20180803 20180328 20210801 IID00385 Dr1-associated corepressor Dr1-associated protein 1 Negative cofactor 2-alpha Homo sapiens 205 Q14919 Q13448 The association of the DR1/DRAP1 heterodimer with TBP results in a functional repression of both activated and basal transcription of class II genes. This interaction precludes the formation of a transcription-competent complex by inhibiting the association of TFIIA and/or TFIIB with TBP. Can bind to DNA on its own. Nucleus. SL-0191 unkown 0 0 0 0 MPSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHMDGDKGARRGRKPGSGGRKNGGMGTKSKDKKLSGTDSEQEDESEDTDTDGEEETSQPPPQASHPSAHFQSPPTPFLPFASTLPLPPAPPGPSAPDEEDEEDYDS 1 1jfiA 1 9 disorder 1 2 1jfiA 10 60 order 1 3 1jfiA 61 63 disorder 1 4 1jfiA 64 75 order 1 5 1jfiA 76 77 disorder 1 1 1jfi X-RAY 293K 5.5 11461703 K.KAMADA,F.SHU,H.CHEN,S.MALIK,G.STELZER,R.G.ROEDER,M.MEISTERERNST,S.K.BURLEY 2001 CELL(CAMBRIDGE,MASS.) 106 71 x-ray 1jfi A 1 77 100 3 1 9 61 63 76 77 1 1jfi_1 2387 Hetero trimer 1jfiB Q01658 IID00206 1jfiA Q14919 IID00385 1jfiC P20226 IID00367 1jfiB-1jfiC 1jfiB-1jfiA 1jfiA-1jfiC 10-75 1-9,76-205 1143 PF00808 11->74 4.7e-23 Histone-like transcription factor (CBF/NF-Y) and archaeal histone hmm pfm 3859 1f66C_ 1->94 2.7e-26 hmm scp 6286 PF00808 11->74 2e-08 Histone-like transcription factor (CBF/NF-Y) and archaeal histone rps pfm 8762 1jfiA 10->75 4e-27 rps scp