20210801 20180803 20180425 20210801 IID50216 Elongin-B Elongin 18 kDa subunit RNA polymerase II transcription factor SIII subunit B SIII p18 Transcription elongation factor B polypeptide 2 Mus musculus 118 P62869 Q63529 Q80W20 The elongin BC complex seems to be involved as an adapter protein in the proteasomal degradation of target proteins via different E3 ubiquitin ligase complexes, including the von Hippel-Lindau ubiquitination complex CBC(VHL). By binding to BC-box motifs it seems to link target recruitment subunits, like VHL and members of the SOCS box family, to Cullin/RBX1 modules that activate E2 ubiquitination enzymes. Nucleus. SL-0191 unkown 0 0 N-acetylmethionine 1 1 Phosphothreonine 84 84 Phosphoserine 108 108 Phosphoserine 111 111 MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPEEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALRIEPFSSPPELPDVMKPQDSGGSANEQAVQ 1 2fnjB 1 98 order 1 2 2fnjB 99 118 disorder 1 3 4jghB 1 104 order 2 4 4jghB 105 118 disorder 2 1 2fnj X-RAY 295K 6.6 16498413 J.S.WOO,J.H.IMM,C.K.MIN,K.J.KIM,S.S.CHA,B.H.OH 2006 EMBO J. 25 1353 x-ray 2fnj B 1 118 100 1 99 118 1 2fnj_1 2141 Hetero trimer 2fnjB P62869 IID50216 2fnjC P83940 IID50219 2fnjA A1Z6E0 2fnjB-2fnjC 2fnjC-2fnjA 2 4jgh X-RAY 295.15K 7 23897481 Y.K.KIM,M.J.KWAK,B.KU,H.Y.SUH,K.JOO,J.LEE,J.U.JUNG,B.H.OH 2013 ACTA CRYSTALLOGR.,SECT.D 69 1587 x-ray 4jgh B 1 118 100 1 105 118 1 4jgh_1 2390 Hetero tetramer 4jghD Q93034 IID00519 4jghA O14508 IID00523 4jghB P62869 IID50216 4jghC P83940 IID50219 4jghD-4jghC 4jghB-4jghC 4jghA-4jghB 4jghD-4jghA 4jghA-4jghC 1-106 107-118 2624 PF00240 10->64 1.1e-11 Ubiquitin family hmm pfm 5007 1lm8B_ 1->105 5.4e-33 hmm scp 9841 1lm8B 1->106 6e-42 rps scp